Página 1 dos resultados de 172 itens digitais encontrados em 0.001 segundos

Ponto-de-não-retorno e períodos de restrição alimentar nos parâmetros zootécnicos e no desenvolvimento muscular de larvas de pacu

Kojima, Juliana Tomomi
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Dissertação de Mestrado Formato: iv, 62 f. : il.
POR
Relevância na Pesquisa
47.02%
Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq); Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP); Pós-graduação em Aquicultura - FCAV; O presente estudo teve como objetivo determinar o ponto-de-não-retorno (PNR) de larvas de pacu (Piaractus mesopotamicus) e avaliar o impacto de diferentes períodos de jejum sobre o crescimento, o desenvolvimento muscular e o crescimento compensatório após diferentes períodos de restrição nas primeiras fases de desenvolvimento. O estudo foi dividido em dois experimentos. O primeiro foi realizado para determinação do PNR, usando delineamento inteiramente casualizado com seis esquemas alimentares e quatro repetições: J0-larvas alimentadas continuamente por 20 dias, J2 - larvas submetidas a dois dias de jejum seguidos por 20 dias de alimentação, J4 - quatro dias de jejum e 20 dias de alimentação, J6 - seis dias de jejum e 20 dias de alimentação, J8 - oito dias de jejum e 20 dias de alimentação e Jn - larvas mantidas em jejum por todo o período experimental. O segundo experimento foi realizado em duas fases: na primeira fase, as larvas foram mantidas em laboratório e passaram pelas mesmas condições de jejum do experimento 1, porém com período de alimentação de 10 dias. Na segunda fase...

Probiótico na alimentação do pacu (Piaractus mesopotamicus): avaliação hematológica, bioquímica, imunológica e desempenho produtivo

Farias, Thaís Heloísa Vaz
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Dissertação de Mestrado Formato: 81 f. : il.
POR
Relevância na Pesquisa
47.02%
Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq); Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP); Pós-graduação em Aquicultura - FCAV; Dentre as espécies nativas criadas no Brasil, o pacu, Piaractus mesopotomicus, tem apresentado aumento em produção, impulsionado pela sua rusticidade, rápido crescimento e carne de boa qualidade. Neste contexto, os estudos sobre a aplicação de probióticos na aqüicultura intensificaram-se, visando à diminuição dos problemas sanitários encontrados nas pisciculturas e a substituição do uso de antibióticos, que têm se tornado uma barreira ao comércio internacional. A eficácia dos probíóticos na aqüicultura pode ser afetada por fatores como o tipo de probiótico e níveis de inclusão na dieta, espécie do hospedeiro e manejo. Diante disso, o objetivo desse trabalho foi avaliar a influência de diferentes níveis de inclusão do probiótico B.subtilis e B.cereus em dietas experimentais para pacu. Neste experimento foram utilizados 660 juvenis de pacus, com peso médio inicial de 67,0 ± 7,0 g, distribuídos em 20 tanques (500 L) e alimentados com probiótico durante 60 dias com quatro níveis de inclusão de Bacillus subtilis e Bacillus cereus (2...

Suplementação de lisina e metionina em dietas práticas com baixo nível protéico para o crescimento inicial de alevinos do pacu (Piaractus mesopotamicus (Holmberg, 1887)

Muñoz Ramírez, Adriana Patrícia
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Dissertação de Mestrado Formato: viii, 51 f.
POR
Relevância na Pesquisa
46.99%
Pós-graduação em Aquicultura - FCAV; O objetivo deste trabalho foi estudar os efeitos da suplementação de metionina ou lisina em dietas práticas com baixo teor protéico usadas para o crescimento inicial do pacu. Em estudo preliminar sobre escore químico da farinha de peixe, milho e dos farelos de soja e trigo, os aminoácidos lisina ou metionina foram determinados como primeiro aminoácido limitante. A partir das análises de composição centesimal e de aminoácidos desses quatro ingredientes foram formuladas oito dietas teste. A dieta basal foi formulada para ter 22% PB, 4100 Kcal/kg EB, 0,42% de metionina e 1,16% de lisina. Outras seis dietas, com esta mesma formulação básica, foram suplementadas com os níveis de 0,2, 0,4 ou 0,6% de metionina ou lisina. Uma oitava dieta contendo 26% de PB, 4100 Kcal/kg EB, 0,48% de metionina e 1,43% de lisina, foi usada como controle, por apresentar níveis mais elevados de aminoácidos ligados à proteína. Foi utilizado um Delineamento Inteiramente Casualizado, com oito tratamentos e três repetições. As dietas foram administradas à vontade, três vezes/dia, durante 93 dias, à 144 alevinos de pacu, com peso médio inicial de 14,98 ± 1,16 g. Analisadas por um estudo de contrastes ortogonais...

Resfriamento de embriões de pacu, Piaractus mesopotamicus (Holmberg, 1887) em diferentes fases do desenvolvimento ontogenético

Lopes, Taís da Silva
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Dissertação de Mestrado Formato: v, 53 f. : il.
POR
Relevância na Pesquisa
46.99%
Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES); Pós-graduação em Aquicultura - FCAV; O objetivo do trabalho foi acompanhar os efeitos durante o resfriamento, em quatro estádios de desenvolvimento embrionário de pacu, Piaractus mesopotamicus, em dois tempos de estocagem, seis e 10 horas. Embriões em quatro estádios de desenvolvimento (blastoderme, 64 células - 1,4-horas pós-fertilização, hpf; 25% do movimento de epibolia - 5,2-hpf; fechamento do blastóporo – 8-hpf e; aparecimento da vesícula óptica - 13,3-hpf) foram expostos a uma solução crioprotetora contendo metanol (10%) e sacarose (0,5M). A seguir, os embriões passaram por curva de resfriamento de 1°C por minuto até -8°C, onde foram mantidos nos dois períodos de estocagem. Utilizou-se delineamento inteiramente casualizado, as taxas de eclosão dos embriões foram avaliados para cada tratamento, com seis repetições, comparando-se com o controle que não foi resfriado. O número total de larvas estimadas para as duas primeiras fases do desenvolvimento ontogenético (1,4- e 5,2- hpf) foi estatisticamente menor que nas demais fases. Entretanto, os estádios de 8 e 13,3- hpf não diferiram entre si (49,90%±6,71 e 55,24%±6,71), respectivamente...

Suplementação dietética de selênio e vitamina E: variáveis fisiológicas e desempenho de juvenis de pacu (Piaractus mesopotamicus)

Gimbo, Rodrigo Yukihiro
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Dissertação de Mestrado Formato: vii, 63 f. : il.
POR
Relevância na Pesquisa
47.06%
Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq); Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP); Pós-graduação em Zootecnia - FCAV; Já é de conhecimento que tanto o selênio quanto a vitamina E possuem capacidades imunoestimulante, separadamente. Entretanto, pouco se sabe sobre a interação desses dois ingredientes em respostas biológicas de juvenis de pacu (Piaractus mesopotamicus). Assim, o objetivo deste trabalho foi avaliar as respostas fisiológicas, imunológicas e zootécnicas desta espécie à administração oral de três níveis de selênio (0; 0,6 e 1,2 mg.kg-1), três níveis de vitamina E (0; 200 e 400 mg.kg-1) e o perfil destas respostas antes e após o desafio com Aeromonas hydrophila). O estudo formou assim, um fatorial 3x3x2, distribuído em delineamento inteiramente casualizado com quatro repetições. Em cada amostragem foram coletados, aleatóriamente, dois peixes de cada aquário para a biometria, coleta de sangue via punção da veia caudal e injeção intraperitoneal de Aeromonas nos peixes restantes. Com os dados da biometria, foram avaliados o ganho de peso, taxa de crescimento específico (TCE) e fator de condição. No sangue, foram determinados o hematócrito...

Proteína bruta na alimentação de matrizes de pacu, Piaractus mesopotamicus mantidas em tanques-rede

Bittencourt, Fábio
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: 110 f. : il.
POR
Relevância na Pesquisa
46.99%
Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES); Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP); Pós-graduação em Aquicultura - FCAV; O objetivo do presente trabalho foi fundamentar o conhecimento das necessidades proteicas de fêmeas de pacu, Piaractus mesopotamicus avaliando-se a qualidade dos ovócitos, seus índices reprodutivos e a ontogenia dos embriões quando mantidas em tanques-rede. Para tanto, o experimento foi conduzido no Centro de Desenvolvimento de Tecnologias para Piscicultura em Tanques-rede localizado no Refúgio Biológico, município de Santa Helena – PR. Foram distribuídos em um delineamento inteiramente casualizado, composto por quatro tratamentos (teores de proteína bruta-PB %) e quatro repetições, 224 reprodutores de pacu em 16 tanques-rede (5,0 m3 cada). Foram formuladas, quatro dietas contendo 18, 24, 30 e 36% de PB, sendo as mesmas isocalóricas, isocálcicas e isofosfóricas para fornecimento aos peixes durante seis meses. No período em que as fêmeas e os machos encontraram- se aptos a desova (dezembro/2009 a janeiro/2010) foram selecionados e aplicadas as doses de extrato hipofisário de carpa. Foram coletadas amostras de ovócitos antes da etapa preparatória e no momento da desova. As mesmas foram divididas em parcelas da seguinte maneira: em solução de Gilson (tamanho ou diâmetro dos ovócitos) e em formol (avaliações histológicas). O restante do material foi fertilizado e disposto em incubadoras cônicas experimentais (20L) para...

Proteína bruta na alimentação de reprodutores do pacu, Piaractus mesopotamicus criados em tanques-rede

Souza, Bruno Estevão de
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: xiii, 95 f. : il.
POR
Relevância na Pesquisa
46.99%
Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES); Pós-graduação em Aquicultura - FCAV; Foi avaliado como as dietas protéicas podem afetar os índices reprodutivos (fertilização e eclosão) e a característica seminal do pacu, Piaractus mesopotamicus criados em tanques-rede. Duzentos e vinte e quatro reprodutores com quatro anos de idade, peso e comprimento médios de 2,62 ± 0,59 Kg e 47,64 ± 2,83 cm respectivamente, foram distribuídos em 16 tanques-rede (5 m³/cada) na proporção de sete machos e sete fêmeas, com densidade de 2,8 peixes m-3 por tanque. Foi utilizado um delineamento experimental inteiramente casualizado, com quatro tratamentos e quatro repetições, sendo os tratamentos (T) constituídos por quatro rações experimentais extrusadas com diferentes níveis de proteína bruta (PB, %): T1 = 18; T2 = 24; T3 = 30 e T4 = 36, isoenergéticas (3.300 kcal kg-1 de ração), isocálcicas e isofosfóricas. Os peixes receberam as rações experimentais pelos seis meses que antecederam o período reprodutivo e, em seguida, foram selecionados a cada dois dias, dois machos e uma fêmea de cada tratamento totalizando-se 12 peixes, pelo período de 22 dias. Os reprodutores foram induzidos hormonalmente...

Digestibilidade e exigência de aminoácidos para juvenis de pacu, Piaractus mesopotamicus

Abimorad, Eduardo Gianini
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: xiii, 82 f.
POR
Relevância na Pesquisa
47.1%
Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq); Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP); Pós-graduação em Aquicultura - FCAV; Neste estudo foram avaliados os coeficientes de digestibilidade aparente (CDA) dos aminoácidos (AA), proteína e energia de seis alimentos utilizados em dietas para o pacu. Os ingredientes apresentaram altos valores de digestibilidade para todos os aminoácidos e diferenças foram detectadas entre os CDA individuais dos aminoácidos dos alimentos (P<0,01). O glúten de milho, o farelo de soja e a farinha de peixe foram os alimentos que apresentaram os maiores CDA para os aminoácidos, mas seus CDA da proteína não devem ser usados como indicativo para a digestibilidade médias dos AA. Dentre os alimentos, o glúten de milho apresentou alto CDA da energia. O escore químico dos alimentos mostrou que a lisina é o primeiro aminoácido limitante para a farinha de peixe, glúten de milho, farelo de trigo e milho e o segundo limitante para o farelo de soja. A metionina apresentou-se como primeiro limitante para o farelo de soja e a levedura. No entanto, o farelo de soja revelou-se a fonte de proteína de melhor qualidade por apresentar o maior índice de aminoácidos essenciais digestíveis (133...

Digestibilidade, desempenho produtivo e parâmetros metabólicos de juvenis de Pacu Piaractus mesopotamicus submetidos a níveis crescentes de fibra bruta

Rodrigues, Laurindo André
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: iv, 66 f.
POR
Relevância na Pesquisa
47.24%
Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES); Pós-graduação em Aquicultura - FCAV; O objetivo deste trabalho foi avaliar a digestibilidade e o tempo de trânsito gastrointestinal (TTGI) de dietas contendo níveis crescentes de fibra bruta (5, 7, 9, 11, 13 e 15%) para pacu. Os experimentos foram realizados no Centro de Aquicultura da UNESP, Jaboticabal - SP. Para o teste de digestibilidade foram utilizados 288 juvenis de pacu (43:1:2,2g) em um delineamento inteiramente casualizado com seis tratamentos e quatro repetições. Os animais foram previamente alimentados em aquários e transferidos para coletores de fezes do tipo Guelf Modificado, utilizando-se o método de coleta parcial de fezes. As rações foram marca das com 1% de oxido de cromio para a determinação da digestibilidade da proteína e energia das dietas. No ensaio de TTGI, 288 pacus (48,25:t3,06g) foram distribuídos em 24 aquários em delineamento inteiramente casualizado. Os peixes foram alimentados com rações contendo 1 % oxido de titânio ou cromio que apreseIitam cores diferentes, verde ou branca. Por meio de massagem abdominal foi averiguada periodicamente a cor das fezes. O TTGI foi estabelecido quando as fezes de todos os peixes apresentaram cor verde. Os coeficientes de digestibilidade aparente da proteína...

Influência da idade e de induções hormonais consecutivas no desempenho reprodutivo do pacu, Piaractus mesopotamicus

Schorer, Marianne
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: xix, 50 p. : il.
POR
Relevância na Pesquisa
47.12%
Pós-graduação em Aquicultura - FCAV; O objetivo deste estudo foi descrever e comparar respectivamente o ciclo e o desempenho reprodutivo de fêmeas de pacu, Piaractus mesopotamicus, de diferentes idades. Além disso, avaliamos o efeito de induções hormonais em anos consecutivos no desempenho reprodutivo desta espécie. Foram utilizados dois grupos de fêmeas, as F1 (10 anos de idade) e as F2 (4 anos de idade) mantidas no Centro de Aquicultura da UNESP (CAUNESP/ Jaboticabal - SP). Para análise do ciclo reprodutivo foram realizadas biometrias nos períodos de vitelogênese (outubro), desova (dezembro) e repouso (março) em dois anos consecutivos. Em cada biometria, 5 a 10 indivíduos de cada grupo foram aleatoriamente separados e submetidos à canulação para obtenção de amostras de ovócitos que foram analisados quanto às características da vesícula germinativa e do diâmetro dos ovócitos. Amostras de sangue, coletadas por punção caudal, foram utilizadas para determinar a concentração plasmática de esteróides gonadais. Para a avaliação comparada do desempenho reprodutivo as fêmeas foram induzidas com extrato bruto de hipófise de carpa (EBHC) (10% - 0,5 mg hipófise kg-1 de peixe; 90% - 5,5 mg de hipófise kg-1 de peixe). Foi determinado o percentual de fêmeas de cada grupo que ovulou e as taxas de fertilidade e eclosão. Amostras das desovas foram coletadas para determinar o diâmetro e o número de ovócitos liberados por Kg de fêmea (fecundidade relativa). Um pool de larvas de cada grupo foi monitorado durante as primeiras 96 horas para determinação da biomassa (g)...

Estresse e imuno modulação por beta-glucano em Pacu (Piaractus mesopotamicus)

Sabioni, Rafael Estevan
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: vi, 90 p.
POR
Relevância na Pesquisa
46.89%
Pós-graduação em Aquicultura - FCAV; Fish farming intensification may increase the frequency and intensity of stressful situations, decreasing productivity. The stress response is established in order to maintain homeostasis, but its extension may decrease the ability of defense, by the action of cortisol, exposing fishes to pathogens. In this sense is studied the strategic use of molecules that have the ability to stimulate the immune system, such as ?-glucan, protecting the fish before stressful events. The immunity of fish is similar to that of mammals and can be monitored through the analysis of some components such as lysozyme, complement system proteins and white cells profile. Pacu was chosen as biological model by its productive characteristics. In this context three experiments were established. The first evaluated the action of ?-glucan-containing feed against a stress condition simulated by intraperitoneal injection of hydrocortisone. The second and third ones tested the action of the?-glucan against the elevation of exogenous and endogenous cortisol, respectively, and Aeromonas hydrophila inoculation. In the overall results, the protocols used to increase endogenous and exogenous cortisol were efficient, however, due to induce cortisol levels above the physiological...

Uso de saponina de quilaia (Quillaja saponaria Molina) em juvenis de pacu

Fernandes, Rosangela do Nascimento
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: viii, 103 f. : il.
POR
Relevância na Pesquisa
47.02%
Pós-graduação em Aquicultura - FCAV; The quillaja saponin (QS) is present in the bark of Chilean and Brazilian trees of the same family, Rosaceae and, it´s able to promote performance and the immune system of animals. Thus, this study evaluated the effect of consuming diets containing increasing levels of QS (0,0; 100,0; 200,0; 300,0; 400,0 mg kg-1) by pacu. Three distinct steps in different consumption diets periods compound by seven, 15, and 30 days. At each step, was used a total of 350 fish, totaling 1050 fishes. These fishes were distributed into 25 cages (200L), in a completely randomized design. In the second chapter, after the feeding period (seven, 15 and 30 days), fish were anesthetized to blood collect and organs for physiological, histological and performance evaluation. The parameters evaluated were the performance (weight gain, apparent feed conversion and feed intake), survival, physiological and histological parameters [hepatosomatic index (HSI), blood cortisol, glucose, cholesterol, triglycerides and intestine histology]. The addition of all levels of QS in the diets of juvenile pacu reduced the triglycerides levels at seven days and HSI at 30 days of feeding. At 15 days of feeding QS diets were observed signals intestinal inflammation in pacu. There was no mortality during the experimental period. In the third chapter...

Ecotoxicidade, segurança clínica e eficácia de fármacos em jovens de pacu (Piaractus mesopotamicus)

Carraschi, Silvia Patrícia
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: xvi, 83 f. : il.
POR
Relevância na Pesquisa
46.89%
Pós-graduação em Aquicultura - FCAV; The therapeutics use in the fish disease treatment is a common practice, due at intensive management and pathogens appearance that can cause high mortality rate. The objectives were to evaluate four drugs: enrofloxacine (ENRO), toltrazuril (TOL); florfenicol (FFC) and thiamethoxan (TH) in the pathogens control in pacu (Piaractus mesopotamicus), to evaluate the hemathological and histopathological variables after treatment and to evaluate the toxicity these drugs for target organism Piaractus mesopotamicus and for bioindicators: mato grosso (Hyphessobrycon eques); Lemna minor; Pomacea canaliculata and Daphnia magna. The organisms were acclimated in room bioassay with controlled temperature according to standard to each one. They were exposed at nominal concentrations in static system. The efficacy of TOL in the Ichthyophthirius multifiliis, Trichodina heterodentata and Anacanthorus penilabiatus control and ENRO, of Aeromonas sp and Streptococcus sp was evaluated in micro and mesocosm condition. The efficacy of TH in the A. penilabiatus control was prospected in laboratory and microcosmo and associated with FFC, in Aeromonas sp e Streptococcus sp control, in mesocosm. After the efficacy in mesocosm the blood was collected for hemathology analysis and tissues for histopatology. FFC...

Condição corporal e jejum sobre o metabolismo energético e crescimento de juvenis de pacu

Favero, Gisele Cristina
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Tese de Doutorado Formato: vii, 64 p. : il.
POR
Relevância na Pesquisa
46.99%
Pós-graduação em Zootecnia - FCAV; The objective of this study was to evaluate the metabolic strategies of pacu (Piaractus mesopotamicus) using fasting and refeeding as a tool. In the first experiment, 450 pacu were divided into 18 tanks of 250 L, at the following treatments: fed for 60 days (control) with formulated diet, and subjected to short alternating cycles of six days of fasting and six of refeeding (6/6); and subjected a long period of 30 days of fasting and refeeding for 30 days (30/30) during 60 days. Each six days 12 fish, per treatment, were sampled to determine the blood variables (glucose and serum triglyceride, cholesterol, fatty acids, and total serum protein) and tissue (glycogen and hepatic lipid, hepatosomatic index (HSI), muscle protein and lipid and mesenteric fat index (MFI)). At the beginning and end of the experiment were determined growth parameters (weight gain (WG), specific growth rate (SGR), food intake, protein efficiency ratio (PER), feed conversion ratio (FCR) and condition factor (K)). Fasting for treatments 6/6 and 30/30 was marked by the use of glucose and plasma triglycerides and increased serum cholesterol and fatty acids. In addition, there was a decrease of glycogen and liver lipid and muscle lipid. On refeeding...

Expressão de microRNAs envolvidos com o crescimento muscular do pacu (Piaractus mesopotamicus): análises in vivo e in vitro

Duran, Bruno Oliveira da Silva
Fonte: Universidade Estadual Paulista (UNESP) Publicador: Universidade Estadual Paulista (UNESP)
Tipo: Dissertação de Mestrado Formato: 62 f.
POR
Relevância na Pesquisa
47.05%
Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP); Processo FAPESP: 2013/01892-2; Pós-graduação em Biologia Geral e Aplicada - IBB; Pacu (Piaractus mesopotamicus) is a Brazilian fish with high economic interest for pisciculture due to features such as rusticity and fast growth. Postnatal growth of skeletal muscle in fish occurs by hyperplasia and/or hypertrophy, processes that are dependent on the proliferation and differentiation of myoblasts. A class of small noncoding RNAs, known as microRNAs (miRNAs), represses the expression of target mRNAs, and many studies demonstrate that miR-1, miR-133, miR-206 and miR-499 regulate different processes in skeletal muscle through the mRNA silencing of HDAC4, SRF, Pax7 and Sox6, respectively. The aim of our work was to evaluate the expression of miRNAs and their putative target mRNAs in fastand slow-twitch skeletal muscle of pacu during growth. Our results revealed an inverse correlation between the expression of miRNAs and their target mRNAs, and there was evidence that miR-1, miR-133 and miR-206 may regulate the proliferation and differentiation of myoblasts. On the other hand, miR-499 was highly expressed in slow-twitch muscle, which suggests its involvement in the specification and maintenance of the slow phenotype in muscle fibres. miRNA expression exhibited variations between different development stages and between distinct muscle twitch phenotypes. This work provided the first identification of miRNA expression profiles related to skeletal muscle in pacu and suggests an important role of these molecules in this tissue; O pacu (Piaractus mesopotamicus) é um peixe brasileiro que apresenta elevado interesse econômico para a piscicultura...

Purificação e caracterização da insulina e de peptideos derivados do proglucagon e prossomatostatina isoladaos do, peixe frugivoro, pacu Piaractus mesopotamicus Holmberg, 1887 (Teleostei, Characidae Serrasalminae)

Jose Augusto Ferraz de Lima
Fonte: Biblioteca Digital da Unicamp Publicador: Biblioteca Digital da Unicamp
Tipo: Tese de Doutorado Formato: application/pdf
Publicado em 03/07/1998 PT
Relevância na Pesquisa
47.29%
O pacu Piraractus mesopotamicus Holmberg, 1887 (Characiformes, Characidae, Serrasalminae) é um peixe teleósteo de água doce, que no seu habitat natural alimenta-se preferencialmente de frutas. Tal qual o tambaqui Colossoma macropomum, o pacu encontra-se classificado, junto com a carpa Cyprinus carpio e o bagre americano Ictalurus punctatus, na superordem Ostariophysi. O tecido pancreático do pacu, semelhante ao tambaqui, exibe uma ilhota principal e pequenos corpos de Brockman. As ilhotas pancreáticas do pacu foram analisadas histologicamente e mostraram os quatro tipos de células endócrinas encontradas nas ilhotas de Langerhans dos mamíferos. Hormônios polipeptídeos, de um extrato de ilhotas principais de pacu, foram purificados com elevado rendimento em fase reversa de HPLC e suas estruturas primárias foram determinadas por degradação automática de Edmann. A estrutura primária da insulina do pacu, foi determinada como - Cadeia A: GIVEQCCHKPCSIFDLQNYCN; Cadeia B: NAGAPQHLCGSHLVDALYLVCGPSGFFYNPK. Em comparação com a insulina da carpa a insulina do pacu contém apenas duas substituições (Glu -+ Asp em AiS e Thr -+ Ser em B24). Comparada com a insulina humana, ambas, contém uma. extensão dipeptídica no N terminal e uma deleção do resíduo C terminal. A insulina do pacu mostrou ser idêntica à insulina do tambaqui o pâncreas do pacu...

Avaliação da intoxicação aguda induzida por atrazina em espécie da ictiofauna do pantanal mato-grossense, pacu (Piaractus mesopotamicus), com o emprego de biomarcadores morfológicos; Morphological biomarkers for assessing acute toxicity of atrazine in pacu (Piaractus mesopotamicus) fingerlings, a freshwater species from the Brazilian pantanal wetland

Paula Pereira de Paiva
Fonte: Biblioteca Digital da Unicamp Publicador: Biblioteca Digital da Unicamp
Tipo: Dissertação de Mestrado Formato: application/pdf
Publicado em 17/12/2010 PT
Relevância na Pesquisa
47.06%
Atrazina é um herbicida muito usado em agricultura intensiva e encontrado com alta freqüência em recursos hídricos na região do Pantanal Mato-grossense. Assim, devido aos riscos que a atrazina pode trazer à ictiofauna da região, foi proposta deste trabalho determinar a CL50 da atrazina em alevinos de pacu (Piaractus mesopotamicus). A determinação da CL50 em 96 h em sistema estático, realizada em duplicata, foi conduzida em aquários de vidro com 8 peixes cada, de peso médio de 5,06±0,31g, avaliando-se as seguintes concentrações nominais de atrazina: 0; 13,2; 17,6; 22,0; 26,4; 30,8; 35,2; 39,6 mg L-1, realizando-se também análise comportamental e análise anatomopatológica. Experimento de intoxicação aguda foi realizado em duplicata, nas mesmas condições do anterior, com a concentração da CL50 obtida (28,58 mg L-1), sendo empregados 6 exemplares de peso médio 6,68±0,36g. Amostras hepáticas e mesonéfricas foram colhidas e processadas para análise de microscopia de luz (ML), realizando-se nestas amostras análise semi-quantitativa das alterações encontradas, e para análise de microscopia eletrônica de transmissão (MET). Quanto à avaliação comportamental, foram observados nos grupos tratados: o escurecimento da pigmentação da pele...

Expressão gênica de fatores que controlam o crescimento muscular do pacu (Piaractus mesopotamicus); Gene expression of factors that control the pacu (Piaractus mesopotamicus) skeletal muscle growth

Fernanda Losi Alves de Almeida
Fonte: Biblioteca Digital da Unicamp Publicador: Biblioteca Digital da Unicamp
Tipo: Tese de Doutorado Formato: application/pdf
Publicado em 22/02/2011 PT
Relevância na Pesquisa
47.02%
Nos peixes, o crescimento muscular ocorre por hipertrofia e hiperplasia a partir da proliferação e diferenciação das células satélites, processos regulados pela expressão de fatores de transcrição e de crescimento. Os objetivos desse trabalho foram: (1) avaliar a morfologia, morfometria e expressão gênica da MyoD, miogenina e IGF-I na musculatura branca do pacu (Piaractus mesopotamicus) com 45, 90, 180, 400 dias pós-eclosão (dpe) e adultos (n=8) e (2) avaliar a expressão gênica da MyoD, miogenina e miostatina na musculatura branca e vermelha de pacus adultos (n=8). Em todos os grupos, fragmentos da musculatura branca foram dissecados e congelados em nitrogênio líquido. Nos adultos, também foram coletados fragmentos de músculo vermelho. Cortes histológicos (10 ?m) da musculatura branca, obtidos em criostato, foram corados com hematoxilina-eosina para avaliação da morfologia e morfometria. Em cada animal, foi determinado o menor diâmetro de 100 fibras musculares brancas que foram distribuídas em classes, na dependência do seu diâmetro (<20 ?m, 20-50 ?m, >50 ?m), para avaliar a hiperplasia e hipertrofia. A expressão gênica foi analisada por reação em cadeia da polimerase após transcrição reversa em tempo real. A morfologia da musculatura branca foi semelhante em todos os grupos. No grupo 45 dpe...

Dejetos suinos como componentes de rações de juvenis pacu (PIARACTUS MESOPOTAMICUS) Holmberg, 1887

Kopp, Everlin Ines
Fonte: Universidade Federal de Santa Catarina Publicador: Universidade Federal de Santa Catarina
Tipo: Dissertação de Mestrado
Relevância na Pesquisa
47.02%
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciencias Agrarias; O trabalho foi realizado no Laboratório de Nutrição de Espécies Aquáticas (LANEA), do Departamento de Aqüicultura, com o objetivo de avaliar o valor nutritivo dos dejetos de suínos, na nutrição de juvenis de pacu (Piaractus mesopotamicus). O experimento teve a duração de 60 dias e foram utilizados 192 juvenis de pacu com peso médio de 30g, provenientes de mesma desova. Os tratamentos foram constituídos de quatro dietas práticas com níveis crescentes de dejetos suínos (0; 10; 20 e 30%) com três repetições cada. A alimentação foi fornecida ad libitum, duas vezes ao dia. A média de temperatura da água das unidades experimentais, permaneceu constante (27oC). Os resultados de desempenho do pacu obtidos não apresentaram diferenças estatísticas (p<0,05) para ganho de peso, conversão alimentar, eficiência alimentar e eficiência protéica, porém, o consumo relativo foi maior para as dietas contendo maior quantidade de dejetos suínos (p<0,05) o que, provavelmente, contribuiu para a igualdade nos dados de crescimento. Os resultados de análise de carcaça mostraram que os peixes alimentados com dejetos na dieta apresentaram um maior teor de proteína bruta e cinzas...

Digestibilidade aparente da proteina e energia de tres tipos de dejetos suinos pela carpa comum cyprinus carpio (Linnaeus, 1758) e pacu Piaractus mesopotamicus (Holmberg, 1887)

Tompson, Marcelo de Morais
Fonte: Universidade Federal de Santa Catarina Publicador: Universidade Federal de Santa Catarina
Tipo: Dissertação de Mestrado Formato: xi, 62f.| retrs
Relevância na Pesquisa
46.95%
Dissertação (Mestrado) - Universidade Federal de Santa Catarina, Centro de Ciencias Agrarias; Dejetos suínos são responsáveis, atualmente, pela contamInação por coliformes fecais de cerca de 85% dos mananciais de água das regiões produtoras de suínos. A possibilidade de utilização destes dejetos como ingrediente de dietas para duas espécies de peixes foi avaliada. Os coeficientes de digestibilidade aparente da matéria seca, proteÍna bruta e energia bruta foram estimados para as dietas referência semi-purificadas LANEA-201 para carpa comum C. carpio e LANEA-301 para o pacu P. mesopotamicus, assim como para três tipos de dejetos suínos (creche, processados e terminação). Foi utilizado o método indireto para determinação dos coeficientes de digestibilidade, com-o óxido crômico como indicador, em um sistema experimental com quatro tanques cilindro-cônicos (1000 litros) e recirculação contínua a partir de um filtro biológico. Os resultados indicaram coeficientes de digestibilidade aparente da matéria seca, proteína bruta e energia bruta de 88.0%, 95.1% e 91.9%, respectivamente para a dieta referência LANEA-201, e 69.7%, 83.0% e 79.4%, respectivamente para a dieta referência LANEA-301. O pacu apresentou coeficientes de digestibilidade aparente da proteína bruta maiores (P<0...